PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_14260V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YB
Protein Properties Length: 296aa    MW: 32007.7 Da    PI: 8.8351
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_14260V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.25.1e-58153248196
              NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                        vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyveplkvyl+kyre
  Pp3c3_14260V3.1.p 153 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLKVYLHKYRE 244
                        69****************************************************************************************** PP

              NF-YB  93 lege 96 
                        +eg+
  Pp3c3_14260V3.1.p 245 TEGA 248
                        *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.3E-56149262IPR009072Histone-fold
SuperFamilySSF471131.35E-40156258IPR009072Histone-fold
PfamPF008089.5E-28159223IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.6E-22187205No hitNo description
PROSITE patternPS006850190206IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.6E-22206224No hitNo description
PRINTSPR006155.6E-22225243No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGKAHSVVPL PNQPPSLPPV ARFASVLPLP PSLAPISPSS LSSCSSYIRC RRCCPLLLPL  60
RPPLPSATPD PLSLPSLPPS LLHCLLGILT LLLHRRLALL GRLLSPTHGI RLGLPFRNIS  120
SMAEAGSPGS QDSPHSDDYG GNHGSGERDN SSVREQDRFL PIANISRIMK KALPANAKIA  180
KDAKETVQEC VSEFISFITS EASDKCQREK RKTINGDDLL WAMSTLGFED YVEPLKVYLH  240
KYRETEGALT NKAGESSSGK KEGSGMVSPG VQQGGYNPYM QAQMMNPGNY QVQHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-47152244193NF-YB
4awl_B2e-47152244294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-47152244294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.109070.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO233101e-66NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0I9RJ591e-126A0A0I9RJ59_PHYPA; CCAAT-box binding factor HAP3-like protein
STRINGPP1S25_89V6.11e-126(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.17e-66nuclear factor Y, subunit B3